Journal cover image: Fluorescently labeled pHLIP® peptides targeting breast cancer tumor in mouse. Pilon-Thomas et al., J Cancer Res, 2016

PAPERS

Reviews

Anemone A, Consolino L, Arena F, Capozza M, Longo DL. Imaging tumor acidosis: a survey of the available techniques for mapping in vivo tumor pH. Cancer Metastasis Rev, 2019.

Tang H, Zhao W, Yu J, Li Y, Zhao C. Recent Development of pH-Responsive Polymers for Cancer Nanomedicine. Molecules, 2018, 24, E4.

Corbet C, Feron O. Tumour acidosis: from the passenger to the driver’s seat. Nat Rev Cancer, 2017, 17, 577-593.

Wyatt LC, Lewis JS, Andreev OA, Reshetnyak YK, Engelman DM. Applications of pHLIP technology for cancer imaging and therapy. Trends Biotechnol, 2017, 35, 653-664.

Li Z, Zhang Y, Zhu D, Li S, Yu X, Zhao Y, Ouyang X, Xie Z, Li L. Transporting carriers for intracellular targeting delivery via non-endocytic uptake pathways. Drug Deliv, 2017, 24, 45-55.

Shrestha S, Cooper LN, Andreev OA, Reshetnyak YK, Antosh MP. Gold Nanoparticles for radiation enhancement in vivo. J Rad Oncology, 2016, 31, 026.

Bernardo BC, Ooi JY, Lin RC, McMullen JR. miRNA therapeutics: a new class of drugs with potential therapeutic applications in the heart. Future Med Chem, 2015, 7, 1771-1792.

Wagner E. Tumor-targeted delivery of anti-microRNA for cancer therapy: pHLIP is key. Angew Chem Int Ed Engl, 2015, 54, 5824-5826.

Pereira MC, Reshetnyak YK, Andreev OA. Advanced targeted nanomedicine. J Biotechnol, 2015, 20, 88-97.

Deacon JC, Engelman DM, Barrera FN. Targeting acidity in diseased tissues: mechanism and applications of the membrane-inserting peptide, pHLIP. Arch Biochem Biophys, 2015, 565, 40-48.

Andreev OA, Engelman DM, Reshetnyak YK. Targeting diseased tissues by pHLIP insertion at low cell surface pH. Front Physiol, 2014, 5, 97.

Han L, Ma H, Guo Y, Kuang Y, He X, Jiang C. pH-Controlled delivery of nanoparticles into tumor cells. Adv Healthc Mater, 2013, 2, 1435-1439.

Fendos J, Engelman D. pHLIP and acidity as a universal biomarker for cancer. Yale J Biol Med, 2012, 85, 29-35.

Andreev OA, Engelman DM, Reshetnyak YK. pH-Sensitive membrane peptides (pHLIPs) as a novel class of delivery agents. Mol Membr Biol, 2010, 27, 341-352.

Andreev OA, Engelman DM, Reshetnyak YK. Targeting acidic diseased tissue: New technology based on use of the pH (Low) Insertion Peptide (pHLIP). Chim Oggi, 2009, 27, 34-37.


Molecular Mechanism

Scott HL, Heberle FA, Katsaras J, Barrera FN. Phosphatidylserine Asymmetry Promotes the Membrane Insertion of a Transmembrane Helix. Biophys J. 2019, S0006-3495, 19, 30189-4.

Rohani N, Hao L, Alexis MS, Joughin BA, Krismer K, Moufarrej MN, Soltis AR,Lauffenburger DA, Yaffe MB, Burge CB, Bhatia SN, Gertler FB. Acidification of tumor at stromal boundaries drives transcriptome alterations associated with aggressive phenotypes. Cancer Res, 2019, 79, 1952-1966.

Gupta C, Ren Y, Mertz B. Cooperative Nonbonded Forces Control Membrane Binding of the pH-Low Insertion Peptide pHLIP. Biophys J, 2018, 115, 2403-2412.

Rinaldi F, Hanieh PN, Del Favero E, Rondelli V, Brocca P, Pereira MC, Andreev OA, Reshetnyak YK, Marianecci C, Carafa M. Decoration of Nanovesicles with pH (Low) Insertion Peptide (pHLIP) for Targeted Delivery. Nanoscale Res Lett, 2018, 13, 391.

Gupta C, Ren Y, Mertz B. Cooperative Nonbonded Forces Control Membrane Binding of the pH-Low Insertion Peptide pHLIP. Biophys J, 2018, 115, 2403-2412.

Otieno SA, Hanz SZ, Chakravorty B, Zhang A, Klees LM, An M, Qiang W. pH-dependent thermodynamic intermediates of pHLIP membrane insertion determined by solid-state NMR spectroscopy. Proc Natl Acad Sci U S A, 2018, 115, 12194-12199.

Rao BD, Chakraborty H, Keller S, Chattopadhyay A. Aggregation Behavior of pHLIP in Aqueous Solution at Low Concentrations: A Fluorescence Study. J Fluoresc, 2018, 28, 967-973.

Vila-Viçosa D, Silva TFD, Slaybaugh G, Reshetnyak YK, Andreev OA, Machuqueiro M. The membrane-induced pK(a) shifts in wt-pHLIP and its L16H variant. J Chem Theory Comput, 2018, 14, 3289-3297.

Karabadzhak AG, Weerakkody D, Deacon J, Andreev OA, Reshetnyak YK, Engelman DM. Bilayer thickness and curvature influence binding and insertion of a pHLIP peptide. Biophys J, 2018, 114, 2107-2115.

Gupta C, Mertz B. Protonation enhances the inherent helix-forming propensity of pHLIP. ACS Omega, 2017, 2, 8536-8542.

Vasquez-Montes V, Gerhart J, King KE, Thévenin D, Ladokhin AS. Comparison of lipid-dependent bilayer insertion of pHLIP and its P20G variant. Biochim Biophys Acta, 2018, 1860, 534-543.

Daniels JL, Crawford TM, Andreev OA, Reshetnyak YK. Synthesis and characterization of pHLIP® coated gold nanoparticles. Biochem Biophys Rep, 2017, 10, 62-69.

Pereira MC, Pianella M, Wei D, Moshnikova A, Marianecci C, Carafa M, Andreev OA, Reshetnyak YK. pH-Sensitive pHLIP® coated niosomes. Mol Membr Biol, 2017, 33, 51-63.

Scott HL, Westerfield JM, Barrera FN. Determination of the membrane translocation pK of the pH-Low Insertion Peptide. Biophys J, 2017, 113, 869-879.

Weerakkody D, Andreev OA, Reshetnyak YK. Insertion into lipid bilayer of truncated pHLIP® peptide. Biochem Biophys Rep, 2016, 8, 290-295.

Narayanan T, Weerakkody D, Karabadzhak AG, Anderson M, Andreev OA, Reshetnyak YK. pHLIP® peptide interaction with membrane monitored by SAXS. J Phys Chem B, 2016, 120, 11484-11491.

Weerakkody D, Moshnikova A, El-Sayed NS, Adochite RC, Slaybaugh G, Golijanin J, Tiwari RK, Andreev OA, Parang K, Reshetnyak YK. Novel pH-sensitive cyclic peptides. Sci Rep, 2016, 6, 31322.

Hanz SZ, Shu NS, Qian J, Christman N, Kranz P, An M, Grewer C, Qiang W., Protonation-driven membrane insertion of a pH-Low Insertion Peptide. Angew Chem Int Ed Engl, 2016, 55, 12376-12381.

Ng DP, Deber CM. Modulating transmembrane α-helix interactions through pH-sensitive boundary residues. Biochemistry, 2016, 55, 4306-4315.

Sharma GP, Reshetnyak YK, Andreev OA, Karbach M, Müller G. Coil-helix transition of polypeptide at water-lipid interface J Stat Mech, 2015, 2015, P01034

Shu NS, Chung MS, Yao L, An M, Qiang W. Residue-specific structures and membrane locations of pH-low insertion peptide by solid-state nuclear magnetic resonance. Nat Commun, 2015, 6, 7787.

Wiedman G, Wimley WC, Hristova K. Testing the limits of rational design by engineering pH sensitivity into membrane-active peptides. Biochim Biophys Acta, 2015, 1848, 951-957.

Onyango JO, Chung MS, Eng CH, Klees LM, Langenbacher R, Yao L, An M. Noncanonical amino acids to improve the pH response of pHLIP insertion at tumor acidity. Angew Chem Int Ed Engl, 2015, 54, 3658-3663.

Scott HL, Nguyen VP, Alves DS, Davis FL, Booth KR, Bryner J, Barrera FN. The negative charge of the membrane has opposite effects on the membrane entry and exit of pH-low insertion peptide. Biochemistry, 2015, 54, 1709-1712.

Kyrychenko A, Vasquez-Montes V, Ulmschneider MB, Ladokhin AS. Lipid headgroups modulate membrane insertion of pHLIP peptide. Biophys J, 2015, 108, 791-794.

Kyrychenko A. NANOGOLD decorated by pHLIP peptide: comparative force field study. Phys Chem Chem Phys, 2015, 17, 12648-12660.

Brown MC, Yakubu RA, Taylor J, Halsey CM, Xiong J, Jiji RD, Cooley JW. Bilayer surface association of the pHLIP peptide promotes extensive backbone desolvation and helically-constrained structures. Biophys Chem, 2014, 187-188, 1-6.

Kong CP, Cui YL, Zhang JL, Zheng QC, Zhang HX. Mechanism of a pH-induced peptide inserting into a POPC bilayer: a molecular dynamic study. Curr Pharm Biotechnol, 2014, 15, 814-822.

Deng Y, Qian Z, Luo Y, Zhang Y, Mu Y, Wei G. Membrane binding and insertion of a pHLIP peptide studied by all-atom molecular dynamics simulations. Int J Mol Sci, 2013, 14, 14532-14549.

Yao L, Daniels J, Wijesinghe D, Andreev OA, Reshetnyak YK. pHLIP®-Mediated delivery of PEGylated liposomes to cancer cells. J Control Release, 2013, 167, 228-237.

Yao L, Daniels J, Moshnikova A, Kuznetsov S, Ahmed A, Engelman DM, Reshetnyak YK, Andreev OA. pHLIP peptide targets nanogold particles to tumors. Proc Natl Acad Sci U S A, 2013, 110, 465-470.

Fendos J, Barrera FN, Engelman DM. Aspartate embedding depth affects pHLIP’s insertion pKa. Biochemistry, 2013, 52, 4595-4604.

Weerakkody D, Moshnikova A, Thakur MS, Moshnikova V, Daniels J, Engelman DM, Andreev OA, Reshetnyak YK. Family of pH (low) insertion peptides for tumor targeting. Proc Natl Acad Sci U S A, 2013, 110, 5834-5839.

Barrera FN, Fendos J, Engelman DM. Membrane physical properties influence transmembrane helix formation. Proc Natl Acad Sci U S A, 2012, 109, 14422-14427.

Karabadzhak AG, Weerakkody D, Wijesinghe D, Thakur MS, Engelman DM, Andreev OA, Markin VS, Reshetnyak YK. Modulation of the pHLIP transmembrane helix insertion pathway. Biophys J, 2012, 102, 1846-1855.

Barrera FN, Weerakkody D, Anderson M, Andreev OA, Reshetnyak YK, Engelman DM. Roles of carboxyl groups in the transmembrane insertion of peptides. J Mol Biol, 2011, 413, 359-371.

Fu L, Liu J, Yan EC. Chiral sum frequency generation spectroscopy for characterizing protein secondary structures at interfaces. J Am Chem Soc, 2011, 133, 8094-8097.

Guo L, Gai F. Heterogeneous diffusion of a membrane-bound pHLIP peptide. Biophys J, 2010, 98, 2914-2922.

Musial-Siwek M, Karabadzhak A, Andreev OA, Reshetnyak YK, Engelman DM. Tuning the insertion properties of pHLIP. Biochim Biophys Acta, 2010, 1798, 1041-1046.

Andreev OA, Karabadzhak AG, Weerakkody D, Andreev GO, Engelman DM, Reshetnyak YK. pH (low) insertion peptide (pHLIP) inserts across a lipid bilayer as a helix and exits by a different path. Proc Natl Acad Sci U S A, 2010, 107, 4081-4086.

Reshetnyak YK, Andreev OA, Segala M, Markin VS, Engelman DM. Energetics of peptide (pHLIP) binding to and folding across a lipid bilayer membrane. Proc Natl Acad Sci U S A, 2008, 105, 15340-15345.

Tang J, Gai F. Dissecting the membrane binding and insertion kinetics of a pHLIP peptide. Biochemistry, 2008, 47, 8250-8252.

Zoonens M, Reshetnyak YK, Engelman DM. Bilayer interactions of pHLIP, a peptide that can deliver drugs and target tumors. Biophys J, 2008, 95, 225-235.

Reshetnyak YK, Segala M, Andreev OA, Engelman DM. A monomeric membrane peptide that lives in three worlds: in solution, attached to, and inserted across lipid bilayers. Biophys J, 2007, 93, 2363-2372.

Hunt JF, Rath P, Rothschild KJ, Engelman DM. Spontaneous, pH-dependent membrane insertion of a transbilayer alpha-helix. Biochemistry, 1997, 36, 15177-15192.


Therapy

Zhang K, Lin H, Mao J, Luo X, Wei R, Su Z, Zhou B, Li D, Gao J, Shan H. An extracellular pH-driven targeted multifunctional manganese arsenite delivery system for tumor imaging and therapy. Biomater Sci. 2019.

Ji T, Lang J, Ning B, Qi F, Wang H, Zhang Y, Zhao R, Yang X, Zhang L, Li W, Shi X, Qin Z, Zhao Y, Nie G. Enhanced Natural Killer Cell Immunotherapy by Rationally Assembling Fc Fragments of Antibodies onto Tumor Membranes. Adv Mater, 2018, 31, 6, e1804395.

Gerhart J, Thévenin AF, Bloch E, King KE, Thévenin D. Inhibiting Epidermal Growth Factor Receptor Dimerization and Signaling Through Targeted Delivery of a Juxtamembrane Domain Peptide Mimic. ACS Chem Biol, 2018, 13, 2623-2632.

Zhao Z, Li C, Song B, Sun J, Fu X, Yang F, Wang H, Yan B. pH low insertion peptide mediated cell division cycle-associated protein 1 -siRNA transportation for prostatic cancer therapy targeted to the tumor microenvironment. Biochem Biophys Res Commun, 2018, 503, 1761-1767.

Gerhart J, Thevenin AF, Bloch E, King KE, Thévenin D. Inhibiting EGFR dimerization and signaling through targeted delivery of a Juxtamembrane domain peptide mimic. ACS Chem Biol, 2018, 13, 2623-2632.

Wyatt LC, Moshnikova A, Crawford T, Engelman DM, Andreev OA, Reshetnyak YK. Peptides of pHLIP family for targeted intracellular and extracellular delivery of cargo molecules to tumors. Proc Natl Acad Sci U S A, 2018, 115, E2811-E2818.

Burns KE, Delehanty JB. Cellular delivery of doxorubicin mediated by disulfide reduction of a peptide-dendrimer bioconjugate. Int J Pharm, 2018, 545, 64-73.

Zhang Y, Ji W, He L, Chen Y, Ding X, Sun Y, Hu S, Yang H, Huang W, Zhang Y, Liu F, Xia L. E. coli Nissle 1917-derived minicells for targeted delivery of chemotherapeutic drug to hypoxic regions for cancer therapy. Theranostics, 2018, 8, 1690-1705.

Qiu L, Valente M, Dolen Y, Jäger E, Beest MT, Zheng L, Figdor CG, Verdoes M. Endolysosomal-escape nanovaccines through adjuvant-induced tumor antigen assembly for enhanced effector CD8(+) T cell activation. Small, 2018, 14, e1703539.

Ding GB, Sun J, Wu G, Li B, Yang P, Li Z, Nie G. Robust anticancer efficacy of a biologically synthesized tumor acidity-responsive and autophagy-inducing functional Beclin 1. ACS Appl Mater Interfaces, 2018, 10, 5227-5239.

Ai F, Wang N, Zhang X, Sun T, Zhu Q, Kong W, Wang F, Zhu G. An upconversion nanoplatform with extracellular pH-driven tumor-targeting ability for improved photodynamic therapy. Nanoscale, 2018, 10, 4432-4441.

Özeş AR, Wang Y, Zong X, Fang F, Pilrose J, Nephew KP. Therapeutic targeting using tumor specific peptides inhibits long non-coding RNA HOTAIR activity in ovarian and breast cancer. Sci Rep, 2017, 7, 894.

Burns KE, Hensley H, Robinson MK, Thévenin D. Therapeutic efficacy of a family of pHLIP-MMAF conjugates in cancer cells and mouse models. Mol Pharm, 2017, 14, 415-422.

Zhang Y, Dang M, Tian Y, Zhu Y, Liu W, Tian W, Su Y, Ni Q, Xu C, Lu N, Tao J, Li Y, Zhao S, Zhao Y, Yang Z, Sun L, Teng Z, Lu G. Tumor acidic microenvironment targeted drug delivery based on pHLIP modified mesoporous organosilica nanoparticles. ACS Appl Mater Interfaces, 2017, 9, 30543-30552.

Tian Y, Zhang Y, Teng Z, Tian W, Luo S, Kong X, Su X, Tang Y, Wang S, Lu G. pH-Dependent transmembrane activity of peptide-functionalized gold nanostars for computed tomography/photoacoustic imaging and photothermal therapy. ACS Appl Mater Interfaces, 2017, 9, 2114-2122.

Burns KE, McCleerey TP, Thévenin D. pH-Selective cytotoxicity of pHLIP-antimicrobial peptide conjugates. Sci Rep, 2016, 6, 28465.

Song Q, Chuan X, Chen B, He B, Zhang H, Dai W, Wang X, Zhang Q. A smart tumor targeting peptide-drug conjugate, pHLIP-SS-DOX: synthesis and cellular uptake on MCF-7 and MCF-7/Adr cells. Drug Deliv, 2016, 23, 1734-1746.

Yu M, Guo F, Wang J, Tan F, Li N. A pH-Driven and photoresponsive nanocarrier: Remotely-controlled by near-infrared light for stepwise antitumor treatment. Biomaterials, 2016, 79, 25-35.

Yu M, Guo F, Wang J, Tan F, Li N. Photosensitizer-loaded pH-responsive hollow gold nanospheres for single light-induced photothermal/photodynamic therapy. ACS Appl Mater Interfaces, 2015, 7, 17592-17597.

Burns KE, Thévenin D. Down-regulation of PAR1 activity with a pHLIP-based allosteric antagonist induces cancer cell death. Biochem J, 2015, 472, 287-295.

Cheng CJ, Bahal R, Babar IA, Pincus Z, Barrera F, Liu C, Svoronos A, Braddock DT, Glazer PM, Engelman DM, Saltzman WM, Slack FJ. MicroRNA silencing for cancer therapy targeted to the tumour microenvironment. Nature, 2015, 518, 107-110.

Li S, Tian Y, Zhao Y, Zhang Y, Su S, Wang J, Wu M, Shi Q, Anderson GJ, Thomsen J, Zhao R, Ji T, Wang J, Nie G. pHLIP-mediated targeting of truncated tissue factor to tumor vessels causes vascular occlusion and impairs tumor growth. Oncotarget, 2015, 6, 23523-23532.

Burns KE, Robinson MK, Thévenin D. Inhibition of cancer cell proliferation and breast tumor targeting of pHLIP-monomethyl auristatin E conjugates. Mol Pharm, 2015, 12, 1250-1258.

Antosh MP, Wijesinghe DD, Shrestha S, Lanou R, Huang YH, Hasselbacher T, Fox D, Neretti N, Sun S, Katenka N, Cooper LN, Andreev OA, Reshetnyak YK. Enhancement of radiation effect on cancer cells by gold-pHLIP. Proc Natl Acad Sci U S A, 2015, 112, 5372-5376.

Wijesinghe D, Arachchige MC, Lu A, Reshetnyak YK, Andreev OA. pH dependent transfer of nano-pores into membrane of cancer cells to induce apoptosis. Sci Rep, 2013, 3, 3560.

Moshnikova A, Moshnikova V, Andreev OA, Reshetnyak YK. Antiproliferative effect of pHLIP-amanitin. Biochemistry, 2013, 52, 1171-1178.

Zhao Z, Meng H, Wang N, Donovan MJ, Fu T, You M, Chen Z, Zhang X, Tan W. A controlled-release nanocarrier with extracellular pH value driven tumor targeting and translocation for drug delivery. Angew Chem Int Ed Engl, 2013, 52, 7487-7491.

Wijesinghe D, Engelman DM, Andreev OA, Reshetnyak YK. Tuning a polar molecule for selective cytoplasmic delivery by a pH (Low) insertion peptide., Biochemistry, 2011, 50, 10215-10222.

An M, Wijesinghe D, Andreev OA, Reshetnyak YK, Engelman DM. pH-(low)-insertion-peptide (pHLIP) translocation of membrane impermeable phalloidin toxin inhibits cancer cell proliferation. Proc Natl Acad Sci U S A, 2010, 107, 20246-20250.

Thévenin D, An M, Engelman DM. pHLIP-mediated translocation of membrane-impermeable molecules into cells. Chem Biol, 2009, 16, 754-762.

Reshetnyak YK, Andreev OA, Lehnert U, Engelman DM. Translocation of molecules by pH-dependent insertion of a transmembrane helix. Proc Natl Acad Sci U S A, 2006, 103, 6460-6465.


Nuclear Imaging

Demoin DW, Wyatt LC, Edwards KJ, Abdel-Atti D, Sarparanta M, Pourat J, Longo VA, Carlin SD, Engelman DM, Andreev OA, Reshetnyak YK, Viola-Villegas N, Lewis JS. PET imaging of extracellular pH in tumors with (64)Cu- and (18)F-labeled pHLIP peptides: A structure-activity optimization study. Bioconjug Chem, 2016, 27, 2014-2023.

Viola-Villegas NT, Carlin SD, Ackerstaff E, Sevak KK, Divilov V, Serganova I, Kruchevsky N, Anderson M, Blasberg RG, Andreev OA, Engelman DM, Koutcher JA, Reshetnyak YK, Lewis JS. Understanding the pharmacological properties of a metabolic PET tracer in prostate cancer. Proc Natl Acad Sci U S A, 2014, 111, 7254-7259.

Emmetiere F, Irwin C, Viola-Villegas NT, Longo V, Cheal SM, Zanzonico P, Pillarsetty N, Weber WA, Lewis JS, Reiner T. 18F-labeled-bioorthogonal liposomes for in vivo targeting. Bioconjugate Chem, 2013, 24, 1784–1789.

Macholl S, Morrison MS, Iveson P, Arbo BE, Andreev OA, Reshetnyak YK, Engelman DM, Johannesen E. In vivo pH imaging with (99m)Tc-pHLIP. Mol Imaging Biol, 2012, 14, 725-734.

Daumar P, Wanger-Baumann CA, Pillarsetty N, Fabrizio L, Carlin SD, Andreev OA, Reshetnyak YK, Lewis JS. Efficient (18)F-labeling of large 37-amino-acid pHLIP peptide analogues and their biological evaluation. Bioconjug Chem, 2012, 23, 1557-1566.

Vāvere AL, Biddlecombe GB, Spees WM, Garbow JR, Wijesinghe D, Andreev OA, Engelman DM, Reshetnyak YK, Lewis JS. A novel technology for the imaging of acidic prostate tumors by positron emission tomography. Cancer Res, 2009, 69, 4510-4516.


Fluorescence Imaging

Wei D, Engelman DM, Reshetnyak YK, Andreev OA. Mapping pH at Cancer Cell Surfaces. Mol Imaging Biol. 2019,

Brito J, Golijanin B, Kott O, Moshnikova A, Mueller-Leonhard C, Gershman B, Andreev OA, Reshetnyak YK, Amin A, Golijanin D. Ex-vivo Imaging of Upper Tract Urothelial Carcinoma Using Novel ICG-Var3 pHLIP Imaging Agent. Urology 2019, pii:S0090-4295, 19, 30061-30065.

Liao G, Wang L, Yu W. Application of novel targeted molecular imaging probes in the early diagnosis of upper urinary tract epithelial carcinoma. Oncol Lett 2018, 16, 6349-6354.

Brito JM, Reshetnyak YK, Golijanin D. Targeted imaging of urothelium carcinoma in human bladders by an ICG pHLIP® peptide ex vivo: Beyond the Abstract. Uro Today, 2016.

Golijanin J, Amin A, Moshnikova A, Brito JM, Tran TY, Adochite RC, Andreev GO, Crawford T, Engelman DM, Andreev OA, Reshetnyak YK, Golijanin D. Targeted imaging of urothelium carcinoma in human bladders by an ICG pHLIP peptide ex vivo. Proc Natl Acad Sci U S A, 2016, 113, 11829-11834.

Image of fluorescently labeled pHLIP® targeting breast cancer tumors in mouse of the Journal of Cancer Research, March 15, 2016 edition.

Adochite RC, Moshnikova A, Golijanin J, Andreev OA, Katenka NV, Reshetnyak YK. Comparative study of tumor targeting and biodistribution of pH (Low) Insertion Peptides (pHLIP® peptides) conjugated with different fluorescent dyes. Mol Imaging Biol, 2016, 18, 686-696.

Anderson M, Moshnikova A, Engelman DM, Reshetnyak YK, Andreev OA. Probe for the measurement of cell surface pH in vivo and ex vivo. Proc Natl Acad Sci U S A, 2016, 113, 8177-8181.

Tapmeier TT, Moshnikova A, Beech J, Allen D, Kinchesh P, Smart S, Harris A, McIntyre A, Engelman DM, Andreev OA, Reshetnyak YK, Muschel RJ. The pH low insertion peptide pHLIP Variant 3 as a novel marker of acidic malignant lesions. Proc Natl Acad Sci U S A, 2015, 112, 9710-9715.

Cardo L, Thomas SG, Mazharian A, Pikramenou Z, Rappoport JZ, Hannon MJ, Watson SP. Accessible synthetic probes for staining actin inside platelets and megakaryocytes by employing lifeact peptide. Chembiochem, 2015, 16, 1680-1688.

Karabadzhak AG, An M, Yao L, Langenbacher R, Moshnikova A, Adochite RC, Andreev OA, Reshetnyak YK, Engelman DM. pHLIP-FIRE, a cell insertion-triggered fluorescent probe for imaging tumors demonstrates targeted cargo delivery in vivo. ACS Chem Biol, 2014, 9, 2545-2553.

Cruz-Monserrate Z, Roland CL, Deng D, Arumugam T, Moshnikova A, Andreev OA, Reshetnyak YK, Logsdon CD. Targeting pancreatic ductal adenocarcinoma acidic microenvironment. Sci Rep, 2014, 4, 4410.

Luo Z, Loja MN, Farwell DG, Luu QC, Donald PJ, Amott D, Truong AQ, Gandour-Edwards R, Nitin N. Widefield optical imaging of changes in uptake of glucose and tissue extracellular pH in head and neck cancer. Cancer Prev Res, 2014, 7, 1035-1044.

Adochite RC, Moshnikova A, Carlin SD, Guerrieri RA, Andreev OA, Lewis JS, Reshetnyak YK. Targeting breast tumors with pH (low) insertion peptides. Mol Pharm, 2014, 11, 2896-2905.

Loja MN, Luo Z, Greg Farwell D, Luu QC, Donald PJ, Amott D, Truong AQ, Gandour-Edwards RF, Nitin N. Optical molecular imaging detects changes in extracellular pH with the development of head and neck cancer. Int J Cancer, 2013, 132, 1613-1623.

Li N, Yin L, Thévenin D, Yamada Y, Limmon G, Chen J, Chow VT, Engelman DM, Engelward BP. Peptide targeting and imaging of damaged lung tissue in influenza-infected mice. Future Microbiol, 2013, 8, 257-269.

Sosunov EA, Anyukhovsky EP, Sosunov AA, Moshnikova A, Wijesinghe D, Engelman DM, Reshetnyak YK, Andreev OA. pH (low) insertion peptide (pHLIP) targets ischemic myocardium. Proc Natl Acad Sci U S A, 2013, 110, 82-86.

Davies A, Lewis DJ, Watson SP, Thomas SG, Pikramenou Z. pH-controlled delivery of luminescent europium coated nanoparticles into platelets. Proc Natl Acad Sci U S A, 2012, 109, 1862-1867.

Reshetnyak YK, Yao L, Zheng S, Kuznetsov S, Engelman DM, Andreev OA. Measuring tumor aggressiveness and targeting metastatic lesions with fluorescent pHLIP. Mol Imaging Biol, 2011, 13, 1146-1156.

Segala J, Engelman DM, Reshetnyak YK, Andreev OA. Accurate analysis of tumor margins using a fluorescent pH Low Insertion Peptide (pHLIP). Int J Mol Sci, 2009, 10, 3478-3487.

Shan L. Cy5.5-labeled pH low insertion peptide (pHLIP). Molecular Imaging and Contrast Agent Database (MICAD), Bethesda (MD): National Center for Biotechnology Information (US), 2009, 2004-2013.

Shan L. (64)Cu -1,4,7,10-Tetraazacyclododecane 1,4,7-Tris-acetic acid-10-maleimidoethylacetamide ACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTG. Molecular Imaging and Contrast Agent Database (MICAD), Bethesda (MD): National Center for Biotechnology Information (US), 2004, 2013.

Andreev OA, Dupuy AD, Segala M, Sandugu S, Serra DA, Chichester CO, Engelman DM, Reshetnyak YK. Mechanism and uses of a membrane peptide that targets tumors and other acidic tissues in vivo. Proc Natl Acad Sci U S A, 2007 104, 7893-7898.


Other Imaging

Tian Y, Zhang Y, Teng Z, Tian W, Luo S, Kong X, Su X, Tang Y, Wang S, Lu G. pH-Dependent transmembrane activity of peptide-functionalized gold nanostars for computed tomography/photoacoustic imaging and photothermal therapy. ACS Appl Mater Interfaces, 2017, 9, 2114-2122.

Wei Y, Liao R, Mahmood AA, Xu H, Zhou Q. pH-responsive pHLIP (pH low insertion peptide) nanoclusters of superparamagnetic iron oxide nanoparticles as a tumor-selective MRI contrast agent. Acta Biomater, 2017, 55, 194-203.

Zeiderman MR, Morgan DE, Christein JD, Grizzle WE, McMasters KM, McNally LR. Acidic pH-targeted chitosan capped mesoporous silica coated gold nanorods facilitate detection of pancreatic tumors via multispectral optoacoustic tomography. ACS Biomater Sci Eng, 2016, 2, 1108-1120.

Janic B, Bhuiyan MP, Ewing JR, Ali MM. pH-Dependent cellular internalization of paramagnetic nanoparticle. ACS Sens, 2016, 1, 975-978.

Reshetnyak YK. Imaging tumor acidity: pH-Low Insertion Peptide probe for optoacoustic tomography. Clin Cancer Res, 2015, 21, 4502-4504.

Kimbrough CW, Khanal A, Zeiderman M, Khanal BR, Burton NC, McMasters KM, Vickers SM, Grizzle WE, McNally LR. Targeting acidity in pancreatic adenocarcinoma: multispectral optoacoustic tomography detects pH-Low Insertion Peptide probes in vivo. Clin Cancer Res, 2015, 21, 4576-4585.